PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG736600.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 154aa    MW: 17514.6 Da    PI: 9.7342
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG736600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.31.3e-251160251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         rie+k  rqv fskRr g++KKA+EL  LCdaeva+++fs+ gklyeyss
  Pavir.5KG736600.3.p 11 RIEDKASRQVRFSKRRSGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 60
                         8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.987262IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-32261IPR002100Transcription factor, MADS-box
CDDcd002655.25E-39379No hitNo description
SuperFamilySSF554552.09E-30485IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-27424IPR002100Transcription factor, MADS-box
PfamPF003194.0E-251158IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-272439IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-273960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MARRGRVELR RIEDKASRQV RFSKRRSGLF KKAFELALLC DAEVALLVFS PAGKLYEYSS  60
TSIEDTYERY QRFAGAGRNA NEGDQNNNDN QDAAASDLQS KLRQISTWSE RNNADKSDPN  120
ELEKLEKLLT NALRDTKTKK VHLSGFVFFH CFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A6e-18473271Myocyte-specific enhancer factor 2A
3kov_B6e-18473271Myocyte-specific enhancer factor 2A
3kov_I6e-18473271Myocyte-specific enhancer factor 2A
3kov_J6e-18473271Myocyte-specific enhancer factor 2A
3p57_A6e-18473271Myocyte-specific enhancer factor 2A
3p57_B6e-18473271Myocyte-specific enhancer factor 2A
3p57_C6e-18473271Myocyte-specific enhancer factor 2A
3p57_D6e-18473271Myocyte-specific enhancer factor 2A
3p57_I6e-18473271Myocyte-specific enhancer factor 2A
3p57_J6e-18473271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.5750.0callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971093.18e-87PREDICTED: truncated transcription factor CAULIFLOWER D-like
TrEMBLA0A0A9D7Q65e-84A0A0A9D7Q6_ARUDO; Uncharacterized protein
STRINGSb03g044170.18e-79(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-29AGAMOUS-like 19